PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G250100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WOX
Protein Properties Length: 531aa    MW: 54207.3 Da    PI: 8.2299
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G250100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.22.2e-1665125257
                           T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                           ++R+++ +eq+++Le+ F++   +p ++e+ ++ ++l    ++ +++V++WFqNr+a+ k+
  Sobic.003G250100.1.p  65 KPRWNPRPEQIRILEAIFNSgMINPPRDEIPRIRMRLqeygQVGDANVFYWFQNRKARSKN 125
                           89*****************99*************************************995 PP

2Wus_type_Homeobox109.42.1e-3564126264
     Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                           +++RW+P+peQi+iLe++++sG+ +P+++ei ri+++L+eyG+++d+NVfyWFQNrkaR+++k
  Sobic.003G250100.1.p  64 PKPRWNPRPEQIRILEAIFNSGMINPPRDEIPRIRMRLQEYGQVGDANVFYWFQNRKARSKNK 126
                           579**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.4E-1159128IPR009057Homeodomain-like
PROSITE profilePS5007110.10661126IPR001356Homeobox domain
SMARTSM003891.3E-663130IPR001356Homeobox domain
CDDcd000861.04E-664126No hitNo description
PfamPF000464.7E-1465124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-665125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MASSFNNSHW PSMFRSKHAA EPWQTQPDIS SSPPSLLSAA GGSTTIGRCL RHPLSGGEER  60
TPDPKPRWNP RPEQIRILEA IFNSGMINPP RDEIPRIRMR LQEYGQVGDA NVFYWFQNRK  120
ARSKNKLRTT TAGAGRLGLG LARAPGRGAA AAAPVTPPPP PPQQQQQSLI QNQFQLLASP  180
AQAPASSSSS SSDRSSGSSK PAAKPAAAQA MSSATAAAMD LLGPLAAACP HQMYYQGRHP  240
VAPVSAPAHK VLDDLDPVLQ QLPQGYCLSA AEVAAILGAG GQYMHVPVQQ QPPAAFSAGA  300
FLGLCNEVTE PTVVTGHRTC AGLGQFWLGG GADHHQLIGK NNTTAATNTV VREVAHEDAT  360
KLGLLQYGFG ASTAMEAAPL AASPAGAAVT VACVAATTAG LTGLPPASTN GVVANYDLLQ  420
GLAGVPGAGA VGVVSTGAGA PAAVAVAAPA SAAAAQEGVV ALCITDTVTG KSVAHNVAAA  480
RLDVRAHFGE AAVLLRGVGE RGLGLEPVPI DASGCTVEPL QHGAFYYVLV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4902411e-152AM490241.1 Zea mays mRNA for putative wuschel homeobox protein (wox9B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288514.10.0WUSCHEL-related homeobox 7-like
SwissprotQ0JKK61e-107WOX7_ORYSJ; WUSCHEL-related homeobox 7
TrEMBLK7V4880.0K7V488_MAIZE; Putative homeobox DNA-binding domain superfamily protein
STRINGGRMZM2G133972_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.17e-41homeobox-3